Lineage for d1wlqe_ (1wlq E:)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 753173Superfamily h.1.28: Geminin coiled-coil domain [111469] (1 family) (S)
  5. 753174Family h.1.28.1: Geminin coiled-coil domain [111470] (1 protein)
  6. 753175Protein Geminin coiled-coil domain [111471] (2 species)
  7. 753181Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry)
  8. 753185Domain d1wlqe_: 1wlq E: [109402]
    Other proteins in same PDB: d1wlqc_, d1wlqf_

Details for d1wlqe_

PDB Entry: 1wlq (more details), 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex
PDB Compounds: (E:) Geminin

SCOP Domain Sequences for d1wlqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlqe_ h.1.28.1 (E:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]}
tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
aevaehvqymaevierls

SCOP Domain Coordinates for d1wlqe_:

Click to download the PDB-style file with coordinates for d1wlqe_.
(The format of our PDB-style files is described here.)

Timeline for d1wlqe_: