Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (33 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.28: Geminin coiled-coil domain [111469] (1 family) |
Family h.1.28.1: Geminin coiled-coil domain [111470] (1 protein) |
Protein Geminin coiled-coil domain [111471] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry) |
Domain d1wlqd_: 1wlq D: [109401] Other proteins in same PDB: d1wlqc_, d1wlqf_ |
PDB Entry: 1wlq (more details), 2.8 Å
SCOP Domain Sequences for d1wlqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlqd_ h.1.28.1 (D:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]} sqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqymaevi erlsn
Timeline for d1wlqd_: