SCOPe 2.04: Domain d1wf4u_: 1wf4 u:

Lineage for d1wf4u_ (1wf4 u:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.1: GroES [50130] (2 proteins)
   automatically mapped to Pfam PF00166

6. Protein Chaperonin-10 (GroES) [50131] (4 species)

7. Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
   Uniprot P61493 ! Uniprot P61492

8. Domain d1wf4u_: 1wf4 u: [109388]
   Other proteins in same PDB: d1wf4a1, d1wf4a2, d1wf4a3, d1wf4b1, d1wf4b2, d1wf4b3, d1wf4c1, d1wf4c2, d1wf4c3, d1wf4d1, d1wf4d2, d1wf4d3, d1wf4e1, d1wf4e2, d1wf4e3, d1wf4f1, d1wf4f2, d1wf4f3, d1wf4g1, d1wf4g2, d1wf4g3, d1wf4h1, d1wf4h2, d1wf4h3, d1wf4i1, d1wf4i2, d1wf4i3, d1wf4j1, d1wf4j2, d1wf4j3, d1wf4k1, d1wf4k2, d1wf4k3, d1wf4l1, d1wf4l2, d1wf4l3, d1wf4m1, d1wf4m2, d1wf4m3, d1wf4n1, d1wf4n2, d1wf4n3
   complexed with adp, dms, mg

Details for d1wf4u_

PDB Entry: 1wf4, 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

PDB Compounds: (u:) cpn10(GroES)

SCOPe Domain Sequences for d1wf4u_:

Sequence; same for both SEQRES and ATOM records:

>d1wf4u_ b.35.1.1 (u:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
kegdivvfakyggteieidgeeyvilserdllavlq

Timeline for d1wf4u_:

• d1wf4u_ first appeared in SCOP 1.69
  
• d1wf4u_ appears in SCOPe 2.03
  
• d1wf4u_ appears in SCOPe 2.05
  
• d1wf4u_ appears in the current release, SCOPe 2.08