Lineage for d1wf4u_ (1wf4 u:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785354Family b.35.1.1: GroES [50130] (2 proteins)
    automatically mapped to Pfam PF00166
  6. 2785355Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 2785447Species Thermus thermophilus [TaxId:274] [110172] (3 PDB entries)
    Uniprot P61493 ! Uniprot P61492
  8. 2785461Domain d1wf4u_: 1wf4 u: [109388]
    Other proteins in same PDB: d1wf4a1, d1wf4a2, d1wf4a3, d1wf4b1, d1wf4b2, d1wf4b3, d1wf4c1, d1wf4c2, d1wf4c3, d1wf4d1, d1wf4d2, d1wf4d3, d1wf4e1, d1wf4e2, d1wf4e3, d1wf4f1, d1wf4f2, d1wf4f3, d1wf4g1, d1wf4g2, d1wf4g3, d1wf4h1, d1wf4h2, d1wf4h3, d1wf4i1, d1wf4i2, d1wf4i3, d1wf4j1, d1wf4j2, d1wf4j3, d1wf4k1, d1wf4k2, d1wf4k3, d1wf4l1, d1wf4l2, d1wf4l3, d1wf4m1, d1wf4m2, d1wf4m3, d1wf4n1, d1wf4n2, d1wf4n3
    complexed with adp, dms, mg
    complexed with adp, dms, mg

Details for d1wf4u_

PDB Entry: 1wf4 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
PDB Compounds: (u:) cpn10(GroES)

SCOPe Domain Sequences for d1wf4u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf4u_ b.35.1.1 (u:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]}
ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
kegdivvfakyggteieidgeeyvilserdllavlq

SCOPe Domain Coordinates for d1wf4u_:

Click to download the PDB-style file with coordinates for d1wf4u_.
(The format of our PDB-style files is described here.)

Timeline for d1wf4u_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wf4a1, d1wf4a2, d1wf4a3, d1wf4b1, d1wf4b2, d1wf4b3, d1wf4c1, d1wf4c2, d1wf4c3, d1wf4d1, d1wf4d2, d1wf4d3, d1wf4e1, d1wf4e2, d1wf4e3, d1wf4f1, d1wf4f2, d1wf4f3, d1wf4g1, d1wf4g2, d1wf4g3, d1wf4h1, d1wf4h2, d1wf4h3, d1wf4i1, d1wf4i2, d1wf4i3, d1wf4j1, d1wf4j2, d1wf4j3, d1wf4k1, d1wf4k2, d1wf4k3, d1wf4l1, d1wf4l2, d1wf4l3, d1wf4m1, d1wf4m2, d1wf4m3, d1wf4n1, d1wf4n2, d1wf4n3, d1wf4o_, d1wf4p_, d1wf4q_, d1wf4r_, d1wf4s_, d1wf4t_