Lineage for d1we3r_ (1we3 R:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461906Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 461907Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 461908Family b.35.1.1: GroES [50130] (2 proteins)
  6. 461909Protein Chaperonin-10 (GroES) [50131] (4 species)
  7. 461962Species Thermus thermophilus [TaxId:274] [110172] (2 PDB entries)
  8. 461966Domain d1we3r_: 1we3 R: [109333]
    Other proteins in same PDB: d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3

Details for d1we3r_

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

SCOP Domain Sequences for d1we3r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3r_ b.35.1.1 (R:) Chaperonin-10 (GroES) {Thermus thermophilus}
ktvikplgdrvvvkrieeepktkggivlpdtakekpqkgkviavgtgrvlengqrvplev
kegdivvfakyggteieidgeeyvilserdllavlq

SCOP Domain Coordinates for d1we3r_:

Click to download the PDB-style file with coordinates for d1we3r_.
(The format of our PDB-style files is described here.)

Timeline for d1we3r_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3c1, d1we3c2, d1we3c3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3s_, d1we3t_, d1we3u_