SCOP 1.73: Domain d1we3n2: 1we3 N:190-373

Lineage for d1we3n2 (1we3 N:190-373)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
this domain is thought to be mobile in most multi-domain proteins known to contain it

Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
Protein GroEL, A domain [52031] (4 species)
Species Thermus thermophilus [TaxId:274] [52033] (3 PDB entries)

Domain d1we3n2: 1we3 N:190-373 [109328]
Other proteins in same PDB: d1we3a1, d1we3a3, d1we3b1, d1we3b3, d1we3c1, d1we3c3, d1we3d1, d1we3d3, d1we3e1, d1we3e3, d1we3f1, d1we3f3, d1we3g1, d1we3g3, d1we3h1, d1we3h3, d1we3i1, d1we3i3, d1we3j1, d1we3j3, d1we3k1, d1we3k3, d1we3l1, d1we3l3, d1we3m1, d1we3m3, d1we3n1, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_
complexed with adp, dms, mg

Details for d1we3n2

PDB Entry: 1we3 (more details), 2.8 Å

PDB Description: Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus

PDB Compounds: (N:) cpn60(GroEL)

SCOP Domain Sequences for d1we3n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we3n2 c.8.5.1 (N:190-373) GroEL, A domain {Thermus thermophilus [TaxId: 274]}
egyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkpllii
aedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfkle
natlsmlgraervritkdettivggkgkkediearingikkelettdseyareklqerla
klag

SCOP Domain Coordinates for d1we3n2:

Click to download the PDB-style file with coordinates for d1we3n2.
(The format of our PDB-style files is described here.)

Timeline for d1we3n2: