| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) ![]() |
| Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein) |
| Protein GroEL, A domain [52031] (3 species) |
| Species Thermus thermophilus [TaxId:274] [52033] (3 PDB entries) |
| Domain d1we3c2: 1we3 C:190-373 [109295] Other proteins in same PDB: d1we3a1, d1we3a3, d1we3b1, d1we3b3, d1we3c1, d1we3c3, d1we3d1, d1we3d3, d1we3e1, d1we3e3, d1we3f1, d1we3f3, d1we3g1, d1we3g3, d1we3h1, d1we3h3, d1we3i1, d1we3i3, d1we3j1, d1we3j3, d1we3k1, d1we3k3, d1we3l1, d1we3l3, d1we3m1, d1we3m3, d1we3n1, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ |
PDB Entry: 1we3 (more details), 2.8 Å
SCOP Domain Sequences for d1we3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we3c2 c.8.5.1 (C:190-373) GroEL, A domain {Thermus thermophilus}
egyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkpllii
aedvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfkle
natlsmlgraervritkdettivggkgkkediearingikkelettdseyareklqerla
klag
Timeline for d1we3c2:
View in 3DDomains from other chains: (mouse over for more information) d1we3a1, d1we3a2, d1we3a3, d1we3b1, d1we3b2, d1we3b3, d1we3d1, d1we3d2, d1we3d3, d1we3e1, d1we3e2, d1we3e3, d1we3f1, d1we3f2, d1we3f3, d1we3g1, d1we3g2, d1we3g3, d1we3h1, d1we3h2, d1we3h3, d1we3i1, d1we3i2, d1we3i3, d1we3j1, d1we3j2, d1we3j3, d1we3k1, d1we3k2, d1we3k3, d1we3l1, d1we3l2, d1we3l3, d1we3m1, d1we3m2, d1we3m3, d1we3n1, d1we3n2, d1we3n3, d1we3o_, d1we3p_, d1we3q_, d1we3r_, d1we3s_, d1we3t_, d1we3u_ |