Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (14 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Fatty oxidation complex alpha subunit, middle domain [110432] (1 species) |
Species Pseudomonas fragi [TaxId:296] [110433] (3 PDB entries) |
Domain d1wdmb3: 1wdm B:311-496 [109280] Other proteins in same PDB: d1wdma1, d1wdma2, d1wdma4, d1wdmb1, d1wdmb2, d1wdmb4, d1wdmc1, d1wdmc2, d1wdmd1, d1wdmd2 |
PDB Entry: 1wdm (more details), 3.8 Å
SCOP Domain Sequences for d1wdmb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdmb3 c.2.1.6 (B:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi} akdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakllvgrvdkgrm tpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvredailasnts tisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattvayakkmgknpi vvndcp
Timeline for d1wdmb3: