Lineage for d1wdlb1 (1wdl B:496-620)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446391Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 446392Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 446429Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 446430Protein Fatty oxidation complex alpha subunit, C-terminal domain [109949] (1 species)
    duplication: contains two repeats of this domain
  7. 446431Species Pseudomonas fragi [TaxId:296] [109950] (3 PDB entries)
  8. 446438Domain d1wdlb1: 1wdl B:496-620 [109266]
    Other proteins in same PDB: d1wdla3, d1wdla4, d1wdlb3, d1wdlb4, d1wdlc1, d1wdlc2, d1wdld1, d1wdld2

Details for d1wdlb1

PDB Entry: 1wdl (more details), 3.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form II (native4)
PDB Compounds: (B:)

SCOP Domain Sequences for d1wdlb1:

Sequence, based on SEQRES records: (download)

>d1wdlb1 a.100.1.3 (B:496-620) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi}
pgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpaylmdvvgidtghhgrdv
maegfpdrmkddrrsaidalyeakrlgqkngkgfyayeadkkgkqkklvdssvlevlkpi
vyeqr

Sequence, based on observed residues (ATOM records): (download)

>d1wdlb1 a.100.1.3 (B:496-620) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi}
pgflvnrvlfpyfggfaklvsagvdfvridkvmekfgwpmgpaylmdvvgidtghhgrdv
maegfpdrmkddrrsaidalyeakrlgqkngkgfyayklvdssvlevlkpivyeqr

SCOP Domain Coordinates for d1wdlb1:

Click to download the PDB-style file with coordinates for d1wdlb1.
(The format of our PDB-style files is described here.)

Timeline for d1wdlb1: