Lineage for d1wdla3 (1wdl A:311-496)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575826Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (15 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 575863Protein Fatty oxidation complex alpha subunit, middle domain [110432] (1 species)
  7. 575864Species Pseudomonas fragi [TaxId:296] [110433] (3 PDB entries)
  8. 575867Domain d1wdla3: 1wdl A:311-496 [109264]
    Other proteins in same PDB: d1wdla1, d1wdla2, d1wdla4, d1wdlb1, d1wdlb2, d1wdlb4, d1wdlc1, d1wdlc2, d1wdld1, d1wdld2

Details for d1wdla3

PDB Entry: 1wdl (more details), 3.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form II (native4)
PDB Compounds: (A:)

SCOP Domain Sequences for d1wdla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdla3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi}
akdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakllvgrvdkgrm
tpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvredailasnts
tisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattvayakkmgknpi
vvndcp

SCOP Domain Coordinates for d1wdla3:

Click to download the PDB-style file with coordinates for d1wdla3.
(The format of our PDB-style files is described here.)

Timeline for d1wdla3: