SCOP 1.69: Domain d1wdkc2: 1wdk C:264-391

Lineage for d1wdkc2 (1wdk C:264-391)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (7 proteins)

6. Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species)

7. Species Pseudomonas fragi [TaxId:296] [110757] (3 PDB entries)

8. Domain d1wdkc2: 1wdk C:264-391 [109259]
   Other proteins in same PDB: d1wdka1, d1wdka2, d1wdka3, d1wdka4, d1wdkb1, d1wdkb2, d1wdkb3, d1wdkb4

Details for d1wdkc2

PDB Entry: 1wdk, 2.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form I (native2)

SCOP Domain Sequences for d1wdkc2:

Sequence; same for both SEQRES and ATOM records:

>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi}
gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl
kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg
iatvferv

Timeline for d1wdkc2:

• d1wdkc2 is new in SCOP 1.69
  
• d1wdkc2 appears in SCOP 1.71
  
• d1wdkc2 appears in the current release, SCOPe 2.08