![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
![]() | Superfamily d.126.1: Pentein [55909] (8 families) ![]() |
![]() | Family d.126.1.5: Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111152] (1 protein) # functionally related to the amidinotransferase, similar active sites |
![]() | Protein Peptidylarginine deiminase Pad4, catalytic C-terminal domain [111153] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111154] (7 PDB entries) Uniprot Q9UM07 |
![]() | Domain d1wdaa3: 1wda A:294-663 [109245] Other proteins in same PDB: d1wdaa1, d1wdaa2 complexed with bag, ca, so4 |
PDB Entry: 1wda (more details), 2.3 Å
SCOPe Domain Sequences for d1wdaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdaa3 d.126.1.5 (A:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} apwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdeme igyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlevs ppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghvd eflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsnk tlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvlg khlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrkp fsfkwwnmvp
Timeline for d1wdaa3: