SCOP 1.73: Domain d1wdaa1: 1wda A:113-293

Lineage for d1wdaa1 (1wda A:113-293)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (1 family)

5. Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)

6. Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110086] (7 PDB entries)

8. Domain d1wdaa1: 1wda A:113-293 [109243]
   Other proteins in same PDB: d1wdaa2, d1wdaa3
   complexed with bag, ca, so4; mutant

Details for d1wdaa1

PDB Entry: 1wda, 2.3 Å

PDB Description: crystal structure of human peptidylarginine deiminase type4 (pad4) in complex with benzoyl-l-arginine amide

PDB Compounds: (A:) Protein-arginine deiminase type IV

SCOP Domain Sequences for d1wdaa1:

Sequence, based on SEQRES records:

>d1wdaa1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records):

>d1wdaa1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkqrtwtwgpcgqgaillvncdrdnlessamdceddevldsedlqdms
lmtlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpggkhnmd
fyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv

Timeline for d1wdaa1:

• d1wdaa1 first appeared in SCOP 1.69
  
• d1wdaa1 appears in SCOP 1.71
  
• d1wdaa1 appears in SCOP 1.75
  
• d1wdaa1 appears in the current release, SCOPe 2.08