Lineage for d1wd9a2 (1wd9 A:4-112)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 458363Family b.6.1.6: Peptidylarginine deiminase Pad4, N-terminal domain [110107] (1 protein)
    probably related to cupredoxins but lacking the metal-binding site
  6. 458364Protein Peptidylarginine deiminase Pad4, N-terminal domain [110108] (1 species)
  7. 458365Species Human (Homo sapiens) [TaxId:9606] [110109] (3 PDB entries)
  8. 458367Domain d1wd9a2: 1wd9 A:4-112 [109241]
    Other proteins in same PDB: d1wd9a1, d1wd9a3

Details for d1wd9a2

PDB Entry: 1wd9 (more details), 2.6 Å

PDB Description: calcium bound form of human peptidylarginine deiminase type4 (pad4)

SCOP Domain Sequences for d1wd9a2:

Sequence, based on SEQRES records: (download)

>d1wd9a2 b.6.1.6 (A:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens)}
gtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdiahsppakkkst
gsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta

Sequence, based on observed residues (ATOM records): (download)

>d1wd9a2 b.6.1.6 (A:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens)}
gtlirvtpeqpthavcvlgtltqldicssasfsinaspgvvvdiawpldpgvevtltmka
asgstgdqkvqisyyktppvkallylta

SCOP Domain Coordinates for d1wd9a2:

Click to download the PDB-style file with coordinates for d1wd9a2.
(The format of our PDB-style files is described here.)

Timeline for d1wd9a2: