Lineage for d1wd9a1 (1wd9 A:113-293)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 939126Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (1 family) (S)
  5. 939127Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)
  6. 939128Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)
  7. 939129Species Human (Homo sapiens) [TaxId:9606] [110086] (7 PDB entries)
    Uniprot Q9UM07
  8. 939135Domain d1wd9a1: 1wd9 A:113-293 [109240]
    Other proteins in same PDB: d1wd9a2, d1wd9a3
    complexed with ca, so4

Details for d1wd9a1

PDB Entry: 1wd9 (more details), 2.6 Å

PDB Description: calcium bound form of human peptidylarginine deiminase type4 (pad4)
PDB Compounds: (A:) Protein-arginine deiminase type IV

SCOPe Domain Sequences for d1wd9a1:

Sequence, based on SEQRES records: (download)

>d1wd9a1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records): (download)

>d1wd9a1 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtqrtwtwgpcgqgaillvncdrdnlessamdceddevldsedlqdmslm
tlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpggkhnmdfy
vealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv

SCOPe Domain Coordinates for d1wd9a1:

Click to download the PDB-style file with coordinates for d1wd9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wd9a1: