Lineage for d1wd8a2 (1wd8 A:4-112)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 554319Family b.6.1.6: Peptidylarginine deiminase Pad4, N-terminal domain [110107] (1 protein)
    probably related to cupredoxins but lacking the metal-binding site
  6. 554320Protein Peptidylarginine deiminase Pad4, N-terminal domain [110108] (1 species)
  7. 554321Species Human (Homo sapiens) [TaxId:9606] [110109] (3 PDB entries)
  8. 554324Domain d1wd8a2: 1wd8 A:4-112 [109238]
    Other proteins in same PDB: d1wd8a1, d1wd8a3

Details for d1wd8a2

PDB Entry: 1wd8 (more details), 2.8 Å

PDB Description: Calcium free form of human peptidylarginine deiminase type4 (PAD4)

SCOP Domain Sequences for d1wd8a2:

Sequence, based on SEQRES records: (download)

>d1wd8a2 b.6.1.6 (A:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens)}
gtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdiahsppakkkst
gsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta

Sequence, based on observed residues (ATOM records): (download)

>d1wd8a2 b.6.1.6 (A:4-112) Peptidylarginine deiminase Pad4, N-terminal domain {Human (Homo sapiens)}
gtlirvtpeqpthavcvlgtltqldicsssfsinaspgvvvdiahstwpldpgvevtltm
kaasgstgdqkvqisyygpktppvkallylta

SCOP Domain Coordinates for d1wd8a2:

Click to download the PDB-style file with coordinates for d1wd8a2.
(The format of our PDB-style files is described here.)

Timeline for d1wd8a2: