Lineage for d1w7ab4 (1w7a B:14-116)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209287Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1209318Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 1209319Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 1209320Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 1209321Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1209324Domain d1w7ab4: 1w7a B:14-116 [109225]
    Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa3, d1w7ab1, d1w7ab2, d1w7ab3
    complexed with atp, mg

Details for d1w7ab4

PDB Entry: 1w7a (more details), 2.27 Å

PDB Description: atp bound muts
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1w7ab4:

Sequence, based on SEQRES records: (download)

>d1w7ab4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagipy
havenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Sequence, based on observed residues (ATOM records): (download)

>d1w7ab4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
vnqgesvaicerkvvrivtp

SCOPe Domain Coordinates for d1w7ab4:

Click to download the PDB-style file with coordinates for d1w7ab4.
(The format of our PDB-style files is described here.)

Timeline for d1w7ab4: