Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) |
Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
Protein DNA repair protein MutS, domain II [53152] (2 species) |
Species Escherichia coli [TaxId:562] [53154] (8 PDB entries) Uniprot P23909 2-800 |
Domain d1w7ab3: 1w7a B:117-269 [109224] Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa4, d1w7ab1, d1w7ab2, d1w7ab4 complexed with atp, mg |
PDB Entry: 1w7a (more details), 2.27 Å
SCOPe Domain Sequences for d1w7ab3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7ab3 c.55.6.1 (B:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]} gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca agcllqyakdtqrttlphirsitmereqdsiim
Timeline for d1w7ab3:
View in 3D Domains from other chains: (mouse over for more information) d1w7aa1, d1w7aa2, d1w7aa3, d1w7aa4 |