Lineage for d1w7aa4 (1w7a A:2-116)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031824Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1031855Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 1031856Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 1031857Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 1031858Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1031860Domain d1w7aa4: 1w7a A:2-116 [109221]
    Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa3, d1w7ab1, d1w7ab2, d1w7ab3
    complexed with atp, mg

Details for d1w7aa4

PDB Entry: 1w7a (more details), 2.27 Å

PDB Description: atp bound muts
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1w7aa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7aa4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOPe Domain Coordinates for d1w7aa4:

Click to download the PDB-style file with coordinates for d1w7aa4.
(The format of our PDB-style files is described here.)

Timeline for d1w7aa4: