SCOP 1.75: Domain d1w7aa4: 1w7a A:2-116

Lineage for d1w7aa4 (1w7a A:2-116)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family)

5. Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)

6. Protein DNA repair protein MutS, domain I [55273] (2 species)

7. Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
   Uniprot P23909 2-800

8. Domain d1w7aa4: 1w7a A:2-116 [109221]
   Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa3, d1w7ab1, d1w7ab2, d1w7ab3

Details for d1w7aa4

PDB Entry: 1w7a, 2.27 Å

PDB Description: atp bound muts

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1w7aa4:

Sequence; same for both SEQRES and ATOM records:

>d1w7aa4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Timeline for d1w7aa4:

• d1w7aa4 first appeared in SCOP 1.69
  
• d1w7aa4 appears in SCOP 1.73
  
• d1w7aa4 appears in SCOPe 2.01
  
• d1w7aa4 appears in the current release, SCOPe 2.08