![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) ![]() |
![]() | Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
![]() | Protein DNA repair protein MutS, domain I [55273] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55275] (10 PDB entries) Uniprot P23909 2-800 |
![]() | Domain d1w7aa4: 1w7a A:2-116 [109221] Other proteins in same PDB: d1w7aa1, d1w7aa2, d1w7aa3, d1w7ab1, d1w7ab2, d1w7ab3 |
PDB Entry: 1w7a (more details), 2.27 Å
SCOP Domain Sequences for d1w7aa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7aa4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]} saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
Timeline for d1w7aa4:
![]() Domains from other chains: (mouse over for more information) d1w7ab1, d1w7ab2, d1w7ab3, d1w7ab4 |