Lineage for d1w7aa2 (1w7a A:567-800)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1165644Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1165706Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 1165707Species Escherichia coli [TaxId:562] [52699] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1165709Domain d1w7aa2: 1w7a A:567-800 [109219]
    Other proteins in same PDB: d1w7aa1, d1w7aa3, d1w7aa4, d1w7ab1, d1w7ab3, d1w7ab4
    complexed with atp, mg

Details for d1w7aa2

PDB Entry: 1w7a (more details), 2.27 Å

PDB Description: atp bound muts
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1w7aa2:

Sequence, based on SEQRES records: (download)

>d1w7aa2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records): (download)

>d1w7aa2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgastfmvemtetanilhnateyslvlmde
igrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgd
tiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

SCOPe Domain Coordinates for d1w7aa2:

Click to download the PDB-style file with coordinates for d1w7aa2.
(The format of our PDB-style files is described here.)

Timeline for d1w7aa2: