SCOPe 2.06: Domain d1w68a_: 1w68 A:

Lineage for d1w68a_ (1w68 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47260] (5 PDB entries)
   Uniprot P11157

8. Domain d1w68a_: 1w68 A: [109216]
   complexed with feo

Details for d1w68a_

PDB Entry: 1w68, 2.2 Å

PDB Description: crystal structure of mouse ribonucleotide reductase subunit r2 under oxidizing conditions. a fully occupied dinuclear iron cluster.

PDB Compounds: (A:) ribonucleoside-diphosphate reductase m2 chain

SCOPe Domain Sequences for d1w68a_:

Sequence; same for both SEQRES and ATOM records:

>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]}
vedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpderhf
ishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidtyikd
pkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwl
kkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqeflte
alpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpf

Timeline for d1w68a_:

• d1w68a_ first appeared in SCOP 1.69
  
• d1w68a_ appears in SCOPe 2.05
  
• d1w68a_ appears in SCOPe 2.07
  
• d1w68a_ appears in the current release, SCOPe 2.08