Lineage for d1w68a_ (1w68 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639250Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 639326Species Mouse (Mus musculus) [TaxId:10090] [47260] (5 PDB entries)
  8. 639328Domain d1w68a_: 1w68 A: [109216]
    complexed with feo

Details for d1w68a_

PDB Entry: 1w68 (more details), 2.2 Å

PDB Description: crystal structure of mouse ribonucleotide reductase subunit r2 under oxidizing conditions. a fully occupied dinuclear iron cluster.
PDB Compounds: (A:) ribonucleoside-diphosphate reductase m2 chain

SCOP Domain Sequences for d1w68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]}
vedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpderhf
ishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidtyikd
pkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwl
kkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqeflte
alpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpf

SCOP Domain Coordinates for d1w68a_:

Click to download the PDB-style file with coordinates for d1w68a_.
(The format of our PDB-style files is described here.)

Timeline for d1w68a_: