SCOPe 2.06: Domain d1w3ya3: 1w3y A:541-814

Lineage for d1w3ya3 (1w3y A:541-814)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
   automatically mapped to Pfam PF02278

6. Protein Hyaluronate lyase [50009] (2 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [50010] (18 PDB entries)
   Uniprot Q54873 287-1007

8. Domain d1w3ya3: 1w3y A:541-814 [109170]
   Other proteins in same PDB: d1w3ya1, d1w3ya2
   complexed with pvc, so4, xyl

Details for d1w3ya3

PDB Entry: 1w3y, 1.65 Å

PDB Description: crystal structure of s. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin c

PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1w3ya3:

Sequence; same for both SEQRES and ATOM records:

>d1w3ya3 b.30.5.2 (A:541-814) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

Timeline for d1w3ya3:

• d1w3ya3 first appeared in SCOP 1.69
  
• d1w3ya3 appears in SCOPe 2.05
  
• d1w3ya3 appears in SCOPe 2.07
  
• d1w3ya3 appears in the current release, SCOPe 2.08