SCOPe 2.05: Domain d1w3ya2: 1w3y A:815-890

Lineage for d1w3ya2 (1w3y A:815-890)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
   sandwich, 10 strands in 2 sheets; "folded meander"

4. Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families)

5. Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)

6. Protein Hyaluronate lyase [49867] (2 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [49868] (18 PDB entries)
   Uniprot Q54873 287-1007

8. Domain d1w3ya2: 1w3y A:815-890 [109169]
   Other proteins in same PDB: d1w3ya1, d1w3ya3
   complexed with pvc, so4, xyl

Details for d1w3ya2

PDB Entry: 1w3y, 1.65 Å

PDB Description: crystal structure of s. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin c

PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1w3ya2:

Sequence; same for both SEQRES and ATOM records:

>d1w3ya2 b.24.1.1 (A:815-890) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ssliennetlqsvydakqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayyn
petqesapdqevfkkl

Timeline for d1w3ya2:

• d1w3ya2 first appeared in SCOP 1.69
  
• d1w3ya2 appears in SCOPe 2.04
  
• d1w3ya2 appears in SCOPe 2.06
  
• d1w3ya2 appears in the current release, SCOPe 2.08