Lineage for d1w2bz_ (1w2b Z:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070524Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1070804Domain d1w2bz_: 1w2b Z: [109118]
    50S subunit in complex with the trigger factor
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1w2bz_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s
PDB Compounds: (Z:) ribosomal protein l37e

SCOPe Domain Sequences for d1w2bz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2bz_ i.1.1.2 (Z:) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1w2bz_:

Click to download the PDB-style file with coordinates for d1w2bz_.
(The format of our PDB-style files is described here.)

Timeline for d1w2bz_: