Lineage for d1w2by_ (1w2b Y:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1971716Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 1971851Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 1971998Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1972277Domain d1w2by_: 1w2b Y: [109117]
    50S subunit in complex with the trigger factor
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1w2by_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s
PDB Compounds: (Y:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d1w2by_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2by_ i.1.1.2 (Y:) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOPe Domain Coordinates for d1w2by_:

Click to download the PDB-style file with coordinates for d1w2by_.
(The format of our PDB-style files is described here.)

Timeline for d1w2by_: