SCOP 1.71: Domain d1w2bs_: 1w2b S:

Lineage for d1w2bs_ (1w2b S:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein 50S subunit [58125] (3 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (4 PDB entries)

8. Domain d1w2bs_: 1w2b S: [109111]

Details for d1w2bs_

PDB Entry: 1w2b, 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s

SCOP Domain Sequences for d1w2bs_:

Sequence; same for both SEQRES and ATOM records:

>d1w2bs_ i.1.1.2 (S:) 50S subunit {Archaeon Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1w2bs_:

• d1w2bs_ first appeared in SCOP 1.69
  
• d1w2bs_ appears in SCOP 1.73
  
• d1w2bs_ appears in the current release, SCOPe 2.08