Class i: Low resolution protein structures [58117] (24 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein 50S subunit [58125] (3 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (4 PDB entries) |
Domain d1w2br_: 1w2b R: [109110] |
PDB Entry: 1w2b (more details), 3.5 Å
SCOP Domain Sequences for d1w2br_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2br_ i.1.1.2 (R:) 50S subunit {Archaeon Haloarcula marismortui} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqevasrigvf
Timeline for d1w2br_:
View in 3D Domains from other chains: (mouse over for more information) d1w2b1_, d1w2b2_, d1w2b5_, d1w2ba_, d1w2bb_, d1w2bc_, d1w2bd_, d1w2be_, d1w2bf_, d1w2bg_, d1w2bh_, d1w2bi_, d1w2bj_, d1w2bk_, d1w2bl_, d1w2bm_, d1w2bn_, d1w2bo_, d1w2bp_, d1w2bs_, d1w2bt_, d1w2bu_, d1w2bv_, d1w2bw_, d1w2bx_, d1w2by_, d1w2bz_ |