Lineage for d1w2be_ (1w2b E:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897438Domain d1w2be_: 1w2b E: [109098]
    50S subunit in complex with the trigger factor

Details for d1w2be_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1w2be_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2be_ i.1.1.2 (E:) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvtegweygmevfyshfpmqvnvegdevvienflgekaprrttihg
dtdveidgeeltvsgpdieavgqtaadieqltrindkdvrvfqdgvyitrkpn

SCOP Domain Coordinates for d1w2be_:

Click to download the PDB-style file with coordinates for d1w2be_.
(The format of our PDB-style files is described here.)

Timeline for d1w2be_: