SCOPe 2.06: Domain d1w26b2: 1w26 B:1-131

Lineage for d1w26b2 (1w26 B:1-131)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
   beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e

4. Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (2 families)
   automatically mapped to Pfam PF05697

5. Family d.241.2.1: Trigger factor ribosome-binding domain [102736] (1 protein)

6. Protein Trigger factor ribosome-binding domain [102737] (2 species)

7. Species Escherichia coli [TaxId:562] [102738] (4 PDB entries)
   Uniprot P22257

8. Domain d1w26b2: 1w26 B:1-131 [109089]
   Other proteins in same PDB: d1w26a1, d1w26a3, d1w26b1, d1w26b3

Details for d1w26b2

PDB Entry: 1w26, 2.7 Å

PDB Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins

PDB Compounds: (B:) Trigger Factor

SCOPe Domain Sequences for d1w26b2:

Sequence; same for both SEQRES and ATOM records:

>d1w26b2 d.241.2.1 (B:1-131) Trigger factor ribosome-binding domain {Escherichia coli [TaxId: 562]}
mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
eaievekpive

Timeline for d1w26b2:

• d1w26b2 first appeared in SCOP 1.69
  
• d1w26b2 appears in SCOPe 2.05
  
• d1w26b2 appears in SCOPe 2.07
  
• d1w26b2 appears in the current release, SCOPe 2.08