Lineage for d1w26b1 (1w26 B:248-432)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546272Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 546273Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (2 families) (S)
    there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)
  5. 546274Family a.223.1.1: TF C-terminus [109999] (1 protein)
    Pfam 05698; includes the upstream linker region not covered by the Pfam model
  6. 546275Protein Trigger factor, C-terminal domain [110000] (2 species)
  7. 546276Species Escherichia coli [TaxId:562] [110001] (1 PDB entry)
  8. 546278Domain d1w26b1: 1w26 B:248-432 [109088]
    Other proteins in same PDB: d1w26a2, d1w26a3, d1w26b2, d1w26b3

Details for d1w26b1

PDB Entry: 1w26 (more details), 2.7 Å

PDB Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins

SCOP Domain Sequences for d1w26b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w26b1 a.223.1.1 (B:248-432) Trigger factor, C-terminal domain {Escherichia coli}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

SCOP Domain Coordinates for d1w26b1:

Click to download the PDB-style file with coordinates for d1w26b1.
(The format of our PDB-style files is described here.)

Timeline for d1w26b1: