SCOP 1.73: Domain d1w0oa2: 1w0o A:347-543

Lineage for d1w0oa2 (1w0o A:347-543)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)

6. Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (1 species)
   both domains have this fold
   rest of protein is beta-propeller of six sheets

7. Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries)

8. Domain d1w0oa2: 1w0o A:347-543 [109036]
   Other proteins in same PDB: d1w0oa3
   complexed with ca, dan, sia

Details for d1w0oa2

PDB Entry: 1w0o, 1.9 Å

PDB Description: vibrio cholerae sialidase

PDB Compounds: (A:) sialidase

SCOP Domain Sequences for d1w0oa2:

Sequence; same for both SEQRES and ATOM records:

>d1w0oa2 b.29.1.8 (A:347-543) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 666]}
dvtdqvkersfqiagwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyv
vtlsidesgglvanlngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittw
agevsqenniqfgnadaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklg
wtkiktgntmslygnas

Timeline for d1w0oa2:

• d1w0oa2 first appeared in SCOP 1.69
  
• d1w0oa2 appears in SCOP 1.71
  
• d1w0oa2 appears in SCOP 1.75
  
• d1w0oa2 appears in the current release, SCOPe 2.08