Class b: All beta proteins [48724] (165 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) |
Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein) |
Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (1 species) both domains have this fold rest of protein is beta-propeller of six sheets |
Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries) |
Domain d1w0oa1: 1w0o A:25-216 [109035] Other proteins in same PDB: d1w0oa3 |
PDB Entry: 1w0o (more details), 1.9 Å
SCOP Domain Sequences for d1w0oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0oa1 b.29.1.8 (A:25-216) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 666]} alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva ayrdikfeiqgd
Timeline for d1w0oa1: