Lineage for d1w0ke3 (1w0k E:82-357)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126370Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2126501Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)
  7. 2126550Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
    Uniprot P00829
  8. 2126585Domain d1w0ke3: 1w0k E:82-357 [109022]
    Other proteins in same PDB: d1w0ka1, d1w0ka2, d1w0ka3, d1w0kb1, d1w0kb2, d1w0kb3, d1w0kc1, d1w0kc2, d1w0kc3, d1w0kd1, d1w0kd2, d1w0ke1, d1w0ke2, d1w0kf1, d1w0kf2, d1w0kg_
    complexed with adp, gol, mg, po4

Details for d1w0ke3

PDB Entry: 1w0k (more details), 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase
PDB Compounds: (E:) ATP synthase beta chain, mitochondrial precursor

SCOPe Domain Sequences for d1w0ke3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ke3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d1w0ke3:

Click to download the PDB-style file with coordinates for d1w0ke3.
(The format of our PDB-style files is described here.)

Timeline for d1w0ke3: