Lineage for d1w0kb3 (1w0k B:95-379)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484903Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 484956Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 484959Species Cow (Bos taurus) [TaxId:9913] [88775] (12 PDB entries)
  8. 484964Domain d1w0kb3: 1w0k B:95-379 [109013]
    Other proteins in same PDB: d1w0ka1, d1w0ka2, d1w0kb1, d1w0kb2, d1w0kc1, d1w0kc2, d1w0kd1, d1w0kd2, d1w0kd3, d1w0ke1, d1w0ke2, d1w0ke3, d1w0kf1, d1w0kf2, d1w0kf3, d1w0kg_

Details for d1w0kb3

PDB Entry: 1w0k (more details), 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase

SCOP Domain Sequences for d1w0kb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0kb3 c.37.1.11 (B:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1w0kb3:

Click to download the PDB-style file with coordinates for d1w0kb3.
(The format of our PDB-style files is described here.)

Timeline for d1w0kb3: