SCOPe 2.01: Domain d1w0jf1: 1w0j F:358-474

Lineage for d1w0jf1 (1w0j F:358-474)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88929] (12 PDB entries)
   Uniprot P00829

8. Domain d1w0jf1: 1w0j F:358-474 [109004]
   Other proteins in same PDB: d1w0ja1, d1w0ja2, d1w0ja3, d1w0jb1, d1w0jb2, d1w0jb3, d1w0jc1, d1w0jc2, d1w0jc3, d1w0jd2, d1w0jd3, d1w0je2, d1w0je3, d1w0jf2, d1w0jf3, d1w0jg_
   complexed with adp, bef, gol, mg, po4

Details for d1w0jf1

PDB Entry: 1w0j, 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase

PDB Compounds: (F:) ATP synthase beta chain, mitochondrial precursor

SCOPe Domain Sequences for d1w0jf1:

Sequence; same for both SEQRES and ATOM records:

>d1w0jf1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Timeline for d1w0jf1:

• d1w0jf1 first appeared in SCOP 1.69
  
• d1w0jf1 appears in SCOP 1.75
  
• d1w0jf1 appears in SCOPe 2.02
  
• d1w0jf1 appears in the current release, SCOPe 2.08