Lineage for d1w0je1 (1w0j E:358-474)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002731Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2002732Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2002733Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2002804Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2002853Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 2002876Domain d1w0je1: 1w0j E:358-474 [109001]
    Other proteins in same PDB: d1w0ja1, d1w0ja2, d1w0ja3, d1w0jb1, d1w0jb2, d1w0jb3, d1w0jc1, d1w0jc2, d1w0jc3, d1w0jd2, d1w0jd3, d1w0je2, d1w0je3, d1w0jf2, d1w0jf3, d1w0jg_
    complexed with adp, bef, gol, mg, po4

Details for d1w0je1

PDB Entry: 1w0j (more details), 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase
PDB Compounds: (E:) ATP synthase beta chain, mitochondrial precursor

SCOPe Domain Sequences for d1w0je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0je1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d1w0je1:

Click to download the PDB-style file with coordinates for d1w0je1.
(The format of our PDB-style files is described here.)

Timeline for d1w0je1: