Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries) Uniprot P00829 |
Domain d1w0jd2: 1w0j D:9-81 [108999] Other proteins in same PDB: d1w0ja1, d1w0ja2, d1w0ja3, d1w0jb1, d1w0jb2, d1w0jb3, d1w0jc1, d1w0jc2, d1w0jc3, d1w0jd1, d1w0jd3, d1w0je1, d1w0je3, d1w0jf1, d1w0jf3, d1w0jg_ complexed with adp, bef, gol, mg, po4 |
PDB Entry: 1w0j (more details), 2.2 Å
SCOPe Domain Sequences for d1w0jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0jd2 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d1w0jd2: