Lineage for d1vzoa_ (1vzo A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435440Protein Ribosomal protein S6 kinase alpha 5, Msk1 [111192] (1 species)
    AGC group (?); S6 kinase subfamily; serine/threonine kinase
  7. 1435441Species Human (Homo sapiens) [TaxId:9606] [111193] (1 PDB entry)
    Uniprot O75582 24-345
  8. 1435442Domain d1vzoa_: 1vzo A: [108971]
    complexed with bme, so4

Details for d1vzoa_

PDB Entry: 1vzo (more details), 1.8 Å

PDB Description: the structure of the n-terminal kinase domain of msk1 reveals a novel autoinhibitory conformation for a dual kinase protein
PDB Compounds: (A:) ribosomal protein s6 kinase alpha 5

SCOPe Domain Sequences for d1vzoa_:

Sequence, based on SEQRES records: (download)

>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]}
qlltvkhelrtanltghaekvgienfellkvlgtgaygkvflvrkisghdtgklyamkvl
kkativqkakttehtrterqvlehirqspflvtlhyafqtetklhlildyinggelfthl
sqrerftehevqiyvgeivlalehlhklgiiyrdiklenilldsnghvvltdfglskefv
adeteraydfcgtieymapdivrggdsghdkavdwwslgvlmyelltgaspftvdgekns
qaeisrrilkseppypqemsalakdliqrllmkdpkkrlgcgprdadeikehlffqkinw
ddlaakkvpapfkpvirdeldv

Sequence, based on observed residues (ATOM records): (download)

>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]}
qlltvkhelrtanltghaekvgienfellkvlgtgaygkvflvrkisghdtgklyamkvl
kkativqkakttehtrterqvlehirqspflvtlhyafqtetklhlildyinggelfthl
sqrerftehevqiyvgeivlalehlhklgiiyrdiklenilldsnghvvltdfglskefv
adeteraydfcgtieymapdivrggddkavdwwslgvlmyelltgaspftvdgeknsqae
isrrilkseppypqemsalakdliqrllmkdpkkrlgcgprdadeikehlffqkinwddl
aakkvpapfkpvirdeldv

SCOPe Domain Coordinates for d1vzoa_:

Click to download the PDB-style file with coordinates for d1vzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1vzoa_: