Lineage for d1vyra_ (1vyr A:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins) Protein Pentaerythritol tetranirate reductase [63900] (1 species) Species Enterobacter cloacae [TaxId:550] [63901] (13 PDB entries) 
Domain d1vyra_: 1vyr A: [108906]
Details for d1vyra_
PDB Entry: 1vyr (more details), 0.9 Å
PDB Description: Structure of pentaerythritol tetranitrate reductase complexed with picric acid
SCOP Domain Sequences for d1vyra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae}
aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
psl
SCOP Domain Coordinates for d1vyra_:
Click to download the PDB-style file with coordinates for d1vyra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vyra_:
- d1vyra_ is new in SCOP 1.69
- d1vyra_ appears in SCOP 1.71
- d1vyra_ appears in the current release, SCOPe 2.08
View in 3D