Class b: All beta proteins [48724] (177 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein Toluene-4-monooxygenase system protein C, TmoC [110154] (1 species) |
Species Pseudomonas mendocina [TaxId:300] [110155] (5 PDB entries) Uniprot Q00458 |
Domain d1vm9a_: 1vm9 A: [108886] complexed with edo, fes, mg; mutant |
PDB Entry: 1vm9 (more details), 1.48 Å
SCOPe Domain Sequences for d1vm9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnka
Timeline for d1vm9a_: