Lineage for d1vljb_ (1vlj B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953870Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 1953871Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 1953901Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 1953925Protein NADH-dependent butanol dehydrogenase A (TM0820) [111312] (1 species)
  7. 1953926Species Thermotoga maritima [TaxId:2336] [111313] (1 PDB entry)
    Uniprot Q9WZS7
  8. 1953928Domain d1vljb_: 1vlj B: [108833]
    Structural genomics target
    complexed with fe, nap

Details for d1vljb_

PDB Entry: 1vlj (more details), 1.78 Å

PDB Description: Crystal structure of NADH-dependent butanol dehydrogenase A (TM0820) from Thermotoga maritima at 1.78 A resolution
PDB Compounds: (B:) NADH-dependent butanol dehydrogenase

SCOPe Domain Sequences for d1vljb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vljb_ e.22.1.2 (B:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]}
hhhhhmenfvfhnptkivfgrgtipkigeeiknagirkvlflygggsikkngvydqvvds
lkkhgiewvevsgvkpnpvlskvheavevakkekveavlgvgggsvvdsakavaagalye
gdiwdafigkyqiekalpifdvltisatgtemngnavitnektkekygvsskalypkvsi
idpsvqftlpkeqtvygavdaishileyyfdgsspeisneiaegtirtimkmterliekp
ddyearanlawsatialngtmavgrrggewachriehslsalydiahgaglaivfpawmk
yvyrknpaqferfakkifgfegegeelilkgieafknwlkkvgapvslkdagipeedidk
ivdnvmllveknlkpkgaslgrimvleredvreilklaak

SCOPe Domain Coordinates for d1vljb_:

Click to download the PDB-style file with coordinates for d1vljb_.
(The format of our PDB-style files is described here.)

Timeline for d1vljb_: