![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Non-hem ferritin [63524] (7 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [109783] (1 PDB entry) Uniprot Q9X0L2 |
![]() | Domain d1vlgg_: 1vlg G: [108822] Structural genomics target complexed with fe, gol, so4 |
PDB Entry: 1vlg (more details), 2 Å
SCOPe Domain Sequences for d1vlgg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlgg_ a.25.1.1 (G:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
Timeline for d1vlgg_: