Lineage for d1vlgd_ (1vlg D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536351Protein Non-hem ferritin [63524] (3 species)
  7. 536361Species Thermotoga maritima [TaxId:243274] [109783] (1 PDB entry)
  8. 536365Domain d1vlgd_: 1vlg D: [108819]

Details for d1vlgd_

PDB Entry: 1vlg (more details), 2 Å

PDB Description: crystal structure of ferritin (tm1128) from thermotoga maritima at 2.00 a resolution

SCOP Domain Sequences for d1vlgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlgd_ a.25.1.1 (D:) Non-hem ferritin {Thermotoga maritima}
mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOP Domain Coordinates for d1vlgd_:

Click to download the PDB-style file with coordinates for d1vlgd_.
(The format of our PDB-style files is described here.)

Timeline for d1vlgd_: