Lineage for d1vlgb_ (1vlg B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 639040Protein Non-hem ferritin [63524] (4 species)
  7. 639075Species Thermotoga maritima [TaxId:2336] [109783] (1 PDB entry)
  8. 639077Domain d1vlgb_: 1vlg B: [108817]

Details for d1vlgb_

PDB Entry: 1vlg (more details), 2 Å

PDB Description: crystal structure of ferritin (tm1128) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (B:) Ferritin

SCOP Domain Sequences for d1vlgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlgb_ a.25.1.1 (B:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]}
mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOP Domain Coordinates for d1vlgb_:

Click to download the PDB-style file with coordinates for d1vlgb_.
(The format of our PDB-style files is described here.)

Timeline for d1vlgb_: