SCOPe 2.08: Domain d1vlfw1: 1vlf W:729-875

Lineage for d1vlfw1 (1vlf W:729-875)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)
   Uniprot P80563

8. Domain d1vlfw1: 1vlf W:729-875 [108812]
   Other proteins in same PDB: d1vlfm2, d1vlfn1, d1vlfn2, d1vlfo2, d1vlfp1, d1vlfp2, d1vlfq2, d1vlfr1, d1vlfr2, d1vlfs2, d1vlft1, d1vlft2, d1vlfu2, d1vlfv1, d1vlfv2, d1vlfw2, d1vlfx1, d1vlfx2
   complexed with 4mo, btt, ca, mgd, sf4
   complexed with 4mo, btt, ca, mgd, sf4

Details for d1vlfw1

PDB Entry: 1vlf, 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

PDB Compounds: (W:) Pyrogallol hydroxytransferase large subunit

SCOPe Domain Sequences for d1vlfw1:

Sequence; same for both SEQRES and ATOM records:

>d1vlfw1 b.52.2.2 (W:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

Timeline for d1vlfw1:

• d1vlfw1 first appeared in SCOP 1.69
  
• d1vlfw1 appears in SCOPe 2.07