Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species) |
Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries) Uniprot P80564 |
Domain d1vldx2: 1vld X:1-195 [108767] Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn1, d1vldo1, d1vldo2, d1vldp1, d1vldq1, d1vldq2, d1vldr1, d1vlds1, d1vlds2, d1vldt1, d1vldu1, d1vldu2, d1vldv1, d1vldw1, d1vldw2, d1vldx1 complexed with 4mo, act, ca, mgd, sf4 complexed with 4mo, act, ca, mgd, sf4 |
PDB Entry: 1vld (more details), 2.35 Å
SCOPe Domain Sequences for d1vldx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vldx2 d.58.1.5 (X:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel gtkprvyyknlyrfe
Timeline for d1vldx2: