SCOP 1.69: Domain d1vldr1: 1vld R:196-274

Lineage for d1vldr1 (1vld R:196-274)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.5: Cna protein B-type domain (Pfam 05738) [49478] (1 family)

5. Family b.3.5.1: Cna protein B-type domain (Pfam 05738) [49479] (2 proteins)

6. Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
   the penultimate strand is in the other beta-sheet than in the Cna repeats

7. Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)

8. Domain d1vldr1: 1vld R:196-274 [108754]
   Other proteins in same PDB: d1vldm1, d1vldm2, d1vldn2, d1vldo1, d1vldo2, d1vldp2, d1vldq1, d1vldq2, d1vldr2, d1vlds1, d1vlds2, d1vldt2, d1vldu1, d1vldu2, d1vldv2, d1vldw1, d1vldw2, d1vldx2

Details for d1vldr1

PDB Entry: 1vld, 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

SCOP Domain Sequences for d1vldr1:

Sequence; same for both SEQRES and ATOM records:

>d1vldr1 b.3.5.1 (R:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

Timeline for d1vldr1:

• d1vldr1 is new in SCOP 1.69
  
• d1vldr1 appears in SCOP 1.71
  
• d1vldr1 appears in the current release, SCOPe 2.08