Lineage for d1vkza3 (1vkz A:94-313)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978554Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2978697Protein Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 [56070] (2 species)
  7. 2978700Species Thermotoga maritima [TaxId:2336] [111187] (1 PDB entry)
    Uniprot Q9X0X7
  8. 2978701Domain d1vkza3: 1vkz A:94-313 [108700]
    Other proteins in same PDB: d1vkza1, d1vkza2, d1vkzb1, d1vkzb2
    Structural genomics target
    complexed with edo

Details for d1vkza3

PDB Entry: 1vkz (more details), 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d1vkza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]}
skvyakrfmkkygirtarfevaetpeelrekikkfsppyvikadglargkgvlildskee
tiekgskliigelikgvkgpvvideflagnelsamavvngrnfvilpfvrdykrlmdgdr
gpntggmgswgpveipsdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyile
ynvrlgdpetevivtlnpegfvnavlegyrggkmepvepr

SCOPe Domain Coordinates for d1vkza3:

Click to download the PDB-style file with coordinates for d1vkza3.
(The format of our PDB-style files is described here.)

Timeline for d1vkza3: